CAPZA3 monoclonal antibody (M01A), clone 4D6
  • CAPZA3 monoclonal antibody (M01A), clone 4D6

CAPZA3 monoclonal antibody (M01A), clone 4D6

Ref: AB-H00093661-M01A
CAPZA3 monoclonal antibody (M01A), clone 4D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAPZA3.
Información adicional
Size 200 uL
Gene Name CAPZA3
Gene Alias CAPPA3|Gsg3
Gene Description capping protein (actin filament) muscle Z-line, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 93661
Clone Number 4D6
Iso type IgG2a Kappa

Enviar uma mensagem


CAPZA3 monoclonal antibody (M01A), clone 4D6

CAPZA3 monoclonal antibody (M01A), clone 4D6