TJAP1 monoclonal antibody (M01), clone 2E5
  • TJAP1 monoclonal antibody (M01), clone 2E5

TJAP1 monoclonal antibody (M01), clone 2E5

Ref: AB-H00093643-M01
TJAP1 monoclonal antibody (M01), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TJAP1.
Información adicional
Size 100 ug
Gene Name TJAP1
Gene Alias DKFZp686F06131|PILT|TJP4
Gene Description tight junction associated protein 1 (peripheral)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TJAP1 (NP_542171.1, 77 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 93643
Clone Number 2E5
Iso type IgG2a Kappa

Enviar uma mensagem


TJAP1 monoclonal antibody (M01), clone 2E5

TJAP1 monoclonal antibody (M01), clone 2E5