UBE2Q2 monoclonal antibody (M04), clone 2H3
  • UBE2Q2 monoclonal antibody (M04), clone 2H3

UBE2Q2 monoclonal antibody (M04), clone 2H3

Ref: AB-H00092912-M04
UBE2Q2 monoclonal antibody (M04), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2Q2.
Información adicional
Size 100 ug
Gene Name UBE2Q2
Gene Alias DKFZp762C143
Gene Description ubiquitin-conjugating enzyme E2Q family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2Q2 (NP_775740, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 92912
Clone Number 2H3
Iso type IgG2a Kappa

Enviar uma mensagem


UBE2Q2 monoclonal antibody (M04), clone 2H3

UBE2Q2 monoclonal antibody (M04), clone 2H3