UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)
  • UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00092912-D01P
UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBE2Q2 protein.
Información adicional
Size 100 ug
Gene Name UBE2Q2
Gene Alias DKFZp762C143
Gene Description ubiquitin-conjugating enzyme E2Q family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2Q2 (NP_775740.1, 1 a.a. ~ 375 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 92912

Enviar uma mensagem


UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)