TMEM129 purified MaxPab mouse polyclonal antibody (B01P)
  • TMEM129 purified MaxPab mouse polyclonal antibody (B01P)

TMEM129 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00092305-B01P
TMEM129 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMEM129 protein.
Información adicional
Size 50 ug
Gene Name TMEM129
Gene Alias D4S2561E|FLJ25600
Gene Description transmembrane protein 129
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMCLAASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQAVASSVNTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLLTIRVASTNPAVQAFDIWSWRPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM129 (NP_612394.1, 1 a.a. ~ 232 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 92305

Enviar uma mensagem


TMEM129 purified MaxPab mouse polyclonal antibody (B01P)

TMEM129 purified MaxPab mouse polyclonal antibody (B01P)