TTC30A purified MaxPab mouse polyclonal antibody (B01P)
  • TTC30A purified MaxPab mouse polyclonal antibody (B01P)

TTC30A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00092104-B01P
TTC30A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC30A protein.
Información adicional
Size 50 ug
Gene Name TTC30A
Gene Alias FLJ13946|FLJ77601
Gene Description tetratricopeptide repeat domain 30A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC30A (AAH42848.1, 1 a.a. ~ 665 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 92104

Enviar uma mensagem


TTC30A purified MaxPab mouse polyclonal antibody (B01P)

TTC30A purified MaxPab mouse polyclonal antibody (B01P)