WDR20 MaxPab rabbit polyclonal antibody (D01)
  • WDR20 MaxPab rabbit polyclonal antibody (D01)

WDR20 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00091833-D01
WDR20 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WDR20 protein.
Información adicional
Size 100 uL
Gene Name WDR20
Gene Alias DMR|FLJ33659|MGC33177|MGC33183
Gene Description WD repeat domain 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVHGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKSKSTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WDR20 (AAH28387.1, 1 a.a. ~ 569 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 91833

Enviar uma mensagem


WDR20 MaxPab rabbit polyclonal antibody (D01)

WDR20 MaxPab rabbit polyclonal antibody (D01)