Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WDR20 purified MaxPab mouse polyclonal antibody (B01P)
Abnova
WDR20 purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00091833-B01P
WDR20 purified MaxPab mouse polyclonal antibody (B01P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human WDR20 protein.
Información adicional
Size
50 ug
Gene Name
WDR20
Gene Alias
DMR|FLJ33659|MGC33177|MGC33183
Gene Description
WD repeat domain 20
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVHGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKSKSTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELH
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
WDR20 (AAH28387.1, 1 a.a. ~ 569 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
91833
Enviar uma mensagem
WDR20 purified MaxPab mouse polyclonal antibody (B01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*