Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACY3 purified MaxPab mouse polyclonal antibody (B01P)
Abnova
ACY3 purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00091703-B01P
ACY3 purified MaxPab mouse polyclonal antibody (B01P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human ACY3 protein.
Información adicional
Size
50 ug
Gene Name
ACY3
Gene Alias
ACY-3|HCBP1|MGC9740
Gene Description
aspartoacylase (aminocyclase) 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPL
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ACY3 (NP_542389.1, 1 a.a. ~ 319 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
91703
Enviar uma mensagem
ACY3 purified MaxPab mouse polyclonal antibody (B01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*