ZNF697 MaxPab mouse polyclonal antibody (B01P)
  • ZNF697 MaxPab mouse polyclonal antibody (B01P)

ZNF697 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00090874-B01P
ZNF697 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF697 protein.
Información adicional
Size 50 ug
Gene Name ZNF697
Gene Alias MGC45731
Gene Description zinc finger protein 697
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCSECGETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFSDFSTLTQHQRTHTGEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTHLAQHQKLHLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF697 (AAH33126, 1 a.a. ~ 136 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 90874

Enviar uma mensagem


ZNF697 MaxPab mouse polyclonal antibody (B01P)

ZNF697 MaxPab mouse polyclonal antibody (B01P)