ZNF622 MaxPab rabbit polyclonal antibody (D01)
  • ZNF622 MaxPab rabbit polyclonal antibody (D01)

ZNF622 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00090441-D01
ZNF622 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF622 protein.
Información adicional
Size 100 uL
Gene Name ZNF622
Gene Alias MGC17552|MGC2485|ZPR9
Gene Description zinc finger protein 622
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF622 (NP_219482.1, 1 a.a. ~ 477 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 90441

Enviar uma mensagem


ZNF622 MaxPab rabbit polyclonal antibody (D01)

ZNF622 MaxPab rabbit polyclonal antibody (D01)