TRIM15 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM15 purified MaxPab mouse polyclonal antibody (B01P)

TRIM15 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00089870-B01P
TRIM15 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM15 protein.
Información adicional
Size 50 ug
Gene Name TRIM15
Gene Alias RNF93|ZNF178|ZNFB7
Gene Description tripartite motif-containing 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM15 (AAH38585.1, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 89870

Enviar uma mensagem


TRIM15 purified MaxPab mouse polyclonal antibody (B01P)

TRIM15 purified MaxPab mouse polyclonal antibody (B01P)