WNT3A purified MaxPab rabbit polyclonal antibody (D01P)
  • WNT3A purified MaxPab rabbit polyclonal antibody (D01P)

WNT3A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00089780-D01P
WNT3A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WNT3A protein.
Información adicional
Size 100 ug
Gene Name WNT3A
Gene Alias MGC119418|MGC119419|MGC119420
Gene Description wingless-type MMTV integration site family, member 3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WNT3A (AAI03922.1, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 89780

Enviar uma mensagem


WNT3A purified MaxPab rabbit polyclonal antibody (D01P)

WNT3A purified MaxPab rabbit polyclonal antibody (D01P)