USP45 monoclonal antibody (M01), clone 1H2
  • USP45 monoclonal antibody (M01), clone 1H2

USP45 monoclonal antibody (M01), clone 1H2

Ref: AB-H00085015-M01
USP45 monoclonal antibody (M01), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP45.
Información adicional
Size 100 ug
Gene Name USP45
Gene Alias MGC14793
Gene Description ubiquitin specific peptidase 45
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP45 (XP_371838, 106 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 85015
Clone Number 1H2
Iso type IgG2a Kappa

Enviar uma mensagem


USP45 monoclonal antibody (M01), clone 1H2

USP45 monoclonal antibody (M01), clone 1H2