UBASH3B monoclonal antibody (M01), clone 3G7
  • UBASH3B monoclonal antibody (M01), clone 3G7

UBASH3B monoclonal antibody (M01), clone 3G7

Ref: AB-H00084959-M01
UBASH3B monoclonal antibody (M01), clone 3G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBASH3B.
Información adicional
Size 100 ug
Gene Name UBASH3B
Gene Alias KIAA1959|MGC15437|STS-1|STS1|p70
Gene Description ubiquitin associated and SH3 domain containing, B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84959
Clone Number 3G7
Iso type IgG2b Kappa

Enviar uma mensagem


UBASH3B monoclonal antibody (M01), clone 3G7

UBASH3B monoclonal antibody (M01), clone 3G7