TNFRSF19L monoclonal antibody (M01), clone 3F8
  • TNFRSF19L monoclonal antibody (M01), clone 3F8

TNFRSF19L monoclonal antibody (M01), clone 3F8

Ref: AB-H00084957-M01
TNFRSF19L monoclonal antibody (M01), clone 3F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNFRSF19L.
Información adicional
Size 100 ug
Gene Name RELT
Gene Alias FLJ14993|TNFRSF19L
Gene Description RELT tumor necrosis factor receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF19L (NP_116260, 26 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84957
Clone Number 3F8
Iso type IgG2a Kappa

Enviar uma mensagem


TNFRSF19L monoclonal antibody (M01), clone 3F8

TNFRSF19L monoclonal antibody (M01), clone 3F8