ZNF587 monoclonal antibody (M01), clone 3A3
  • ZNF587 monoclonal antibody (M01), clone 3A3

ZNF587 monoclonal antibody (M01), clone 3A3

Ref: AB-H00084914-M01
ZNF587 monoclonal antibody (M01), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZNF587.
Información adicional
Size 100 ug
Gene Name ZNF587
Gene Alias FLJ14710|FLJ20813|ZF6
Gene Description zinc finger protein 587
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MAVSSQQGEIMESRIFFQGSHAHFPTCMNVDTAATVLAVNVNLASNHCSQGNVPIRRRLSGTLILTGRWDILRDPEAGCHLLNFPEGCLESVSSHSELFFLLWLTKNMEPHKVHCNSFIFVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF587 (AAH17219, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84914
Clone Number 3A3
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF587 monoclonal antibody (M01), clone 3A3

ZNF587 monoclonal antibody (M01), clone 3A3