AMID monoclonal antibody (M09), clone 3A11
  • AMID monoclonal antibody (M09), clone 3A11

AMID monoclonal antibody (M09), clone 3A11

Ref: AB-H00084883-M09
AMID monoclonal antibody (M09), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AMID.
Información adicional
Size 100 ug
Gene Name AIFM2
Gene Alias AMID|PRG3|RP11-367H5.2
Gene Description apoptosis-inducing factor, mitochondrion-associated, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMID (NP_116186, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84883
Clone Number 3A11
Iso type IgG2a Kappa

Enviar uma mensagem


AMID monoclonal antibody (M09), clone 3A11

AMID monoclonal antibody (M09), clone 3A11