TRIM51 MaxPab mouse polyclonal antibody (B01P)
  • TRIM51 MaxPab mouse polyclonal antibody (B01P)

TRIM51 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084767-B01P
TRIM51 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM51 protein.
Información adicional
Size 50 ug
Gene Name SPRYD5
Gene Alias MGC10977|TRIM51
Gene Description SPRY domain containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METTRTRCWKDYVSLRIEAIRAEYQKMPAFLHEEEQHHLERLRKEGEDIFQQLNESKARMEHSRELLRGMYEDLKQMCHKADVELLQAFGDILHRYESLLLQVSEPVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCDPQDDPDITGKSECFLVWGAQAFTSGKYYWEVHMGDSWNWAFGVCNNYWKEKRQNDKIDGEEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM51 (NP_116070.1, 1 a.a. ~ 293 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84767

Enviar uma mensagem


TRIM51 MaxPab mouse polyclonal antibody (B01P)

TRIM51 MaxPab mouse polyclonal antibody (B01P)