ACCS MaxPab rabbit polyclonal antibody (D01)
  • ACCS MaxPab rabbit polyclonal antibody (D01)

ACCS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00084680-D01
ACCS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACCS protein.
Información adicional
Size 100 uL
Gene Name ACCS
Gene Alias ACS|PHACS
Gene Description 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILIS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACCS (AAH20197.1, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 84680

Enviar uma mensagem


ACCS MaxPab rabbit polyclonal antibody (D01)

ACCS MaxPab rabbit polyclonal antibody (D01)