Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VPS25 monoclonal antibody (M01A), clone S2
Abnova
VPS25 monoclonal antibody (M01A), clone S2
Ref: AB-H00084313-M01A
VPS25 monoclonal antibody (M01A), clone S2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant VPS25.
Información adicional
Size
200 uL
Gene Name
VPS25
Gene Alias
DERP9|EAP20|FAP20|MGC10540
Gene Description
vacuolar protein sorting 25 homolog (S. cerevisiae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
84313
Clone Number
S2
Iso type
IgG1 Kappa
Enviar uma mensagem
VPS25 monoclonal antibody (M01A), clone S2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*