C17orf37 monoclonal antibody (M09), clone 4D4
  • C17orf37 monoclonal antibody (M09), clone 4D4

C17orf37 monoclonal antibody (M09), clone 4D4

Ref: AB-H00084299-M09
C17orf37 monoclonal antibody (M09), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C17orf37.
Información adicional
Size 100 ug
Gene Name C17orf37
Gene Alias C35|MGC14832|ORB3|RDX12|XTP4
Gene Description chromosome 17 open reading frame 37
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84299
Clone Number 4D4
Iso type IgG2a Kappa

Enviar uma mensagem


C17orf37 monoclonal antibody (M09), clone 4D4

C17orf37 monoclonal antibody (M09), clone 4D4