C17orf37 MaxPab rabbit polyclonal antibody (D01)
  • C17orf37 MaxPab rabbit polyclonal antibody (D01)

C17orf37 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00084299-D01
C17orf37 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C17orf37 protein.
Información adicional
Size 100 uL
Gene Name C17orf37
Gene Alias C35|MGC14832|ORB3|RDX12|XTP4
Gene Description chromosome 17 open reading frame 37
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 84299

Enviar uma mensagem


C17orf37 MaxPab rabbit polyclonal antibody (D01)

C17orf37 MaxPab rabbit polyclonal antibody (D01)