C2orf7 purified MaxPab mouse polyclonal antibody (B01P)
  • C2orf7 purified MaxPab mouse polyclonal antibody (B01P)

C2orf7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084279-B01P
C2orf7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C2orf7 protein.
Información adicional
Size 50 ug
Gene Name C2orf7
Gene Alias MGC13004|PAP21
Gene Description chromosome 2 open reading frame 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C2orf7 (NP_115695, 1 a.a. ~ 188 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84279

Enviar uma mensagem


C2orf7 purified MaxPab mouse polyclonal antibody (B01P)

C2orf7 purified MaxPab mouse polyclonal antibody (B01P)