ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)
  • ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)

ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084240-B01P
ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZCCHC9 protein.
Información adicional
Size 50 ug
Gene Name ZCCHC9
Gene Alias DKFZp761J139
Gene Description zinc finger, CCHC domain containing 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZCCHC9 (NP_115656.1, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84240

Enviar uma mensagem


ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)

ZCCHC9 purified MaxPab mouse polyclonal antibody (B01P)