USP48 monoclonal antibody (M01), clone 3G4
  • USP48 monoclonal antibody (M01), clone 3G4

USP48 monoclonal antibody (M01), clone 3G4

Ref: AB-H00084196-M01
USP48 monoclonal antibody (M01), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP48.
Información adicional
Size 100 ug
Gene Name USP48
Gene Alias DKFZp762M1713|MGC132556|MGC14879|RAP1GA1|USP31
Gene Description ubiquitin specific peptidase 48
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP48 (NP_115612, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84196
Clone Number 3G4
Iso type IgG1 Kappa

Enviar uma mensagem


USP48 monoclonal antibody (M01), clone 3G4

USP48 monoclonal antibody (M01), clone 3G4