USP48 polyclonal antibody (A01)
  • USP48 polyclonal antibody (A01)

USP48 polyclonal antibody (A01)

Ref: AB-H00084196-A01
USP48 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP48.
Información adicional
Size 50 uL
Gene Name USP48
Gene Alias DKFZp762M1713|MGC132556|MGC14879|RAP1GA1|USP31
Gene Description ubiquitin specific peptidase 48
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP48 (NP_115612, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84196

Enviar uma mensagem


USP48 polyclonal antibody (A01)

USP48 polyclonal antibody (A01)