ASCC2 monoclonal antibody (M07), clone 3B2
  • ASCC2 monoclonal antibody (M07), clone 3B2

ASCC2 monoclonal antibody (M07), clone 3B2

Ref: AB-H00084164-M07
ASCC2 monoclonal antibody (M07), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASCC2.
Información adicional
Size 100 ug
Gene Name ASCC2
Gene Alias ASC1p100
Gene Description activating signal cointegrator 1 complex subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASCC2 (NP_115580, 672 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84164
Clone Number 3B2
Iso type IgG1 Kappa

Enviar uma mensagem


ASCC2 monoclonal antibody (M07), clone 3B2

ASCC2 monoclonal antibody (M07), clone 3B2