ZIC4 monoclonal antibody (M07), clone 2C2
  • ZIC4 monoclonal antibody (M07), clone 2C2

ZIC4 monoclonal antibody (M07), clone 2C2

Ref: AB-H00084107-M07
ZIC4 monoclonal antibody (M07), clone 2C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZIC4.
Información adicional
Size 100 ug
Gene Name ZIC4
Gene Alias FLJ42609|FLJ45833
Gene Description Zic family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84107
Clone Number 2C2
Iso type IgG2a Kappa

Enviar uma mensagem


ZIC4 monoclonal antibody (M07), clone 2C2

ZIC4 monoclonal antibody (M07), clone 2C2