ZIC4 monoclonal antibody (M01), clone 4B1 View larger

Mouse monoclonal antibody raised against a partial recombinant ZIC4.

AB-H00084107-M01

New product

ZIC4 monoclonal antibody (M01), clone 4B1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ZIC4
Gene Alias FLJ42609|FLJ45833
Gene Description Zic family member 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84107
Clone Number 4B1
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ZIC4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ZIC4.

Mouse monoclonal antibody raised against a partial recombinant ZIC4.