ZIC4 polyclonal antibody (A01)
  • ZIC4 polyclonal antibody (A01)

ZIC4 polyclonal antibody (A01)

Ref: AB-H00084107-A01
ZIC4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZIC4.
Información adicional
Size 50 uL
Gene Name ZIC4
Gene Alias FLJ42609|FLJ45833
Gene Description Zic family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84107

Enviar uma mensagem


ZIC4 polyclonal antibody (A01)

ZIC4 polyclonal antibody (A01)