B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)
  • B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)

B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084002-B01P
B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human B3GNT5 protein.
Información adicional
Size 50 ug
Gene Name B3GNT5
Gene Alias B3GN-T5|beta3Gn-T5
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVNDTLSLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B3GNT5 (NP_114436, 1 a.a. ~ 378 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84002

Enviar uma mensagem


B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)

B3GNT5 purified MaxPab mouse polyclonal antibody (B01P)