TFAP2D purified MaxPab mouse polyclonal antibody (B01P)
  • TFAP2D purified MaxPab mouse polyclonal antibody (B01P)

TFAP2D purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00083741-B01P
TFAP2D purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TFAP2D protein.
Información adicional
Size 50 ug
Gene Name TFAP2D
Gene Alias TFAP2BL1
Gene Description transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASPYFSTNHQYTPLHHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQIHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYRRHDLSLMSHGSQYGMHPDQRLLPGPSLGLAAAGADDLQGSVEAQCGLVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFAP2D (NP_758438.1, 1 a.a. ~ 452 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83741

Enviar uma mensagem


TFAP2D purified MaxPab mouse polyclonal antibody (B01P)

TFAP2D purified MaxPab mouse polyclonal antibody (B01P)