TMEM7 polyclonal antibody (A01)
  • TMEM7 polyclonal antibody (A01)

TMEM7 polyclonal antibody (A01)

Ref: AB-H00083597-A01
TMEM7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TMEM7.
Información adicional
Size 50 uL
Gene Name RTP3
Gene Alias LTM1|TMEM7
Gene Description receptor (chemosensory) transporter protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TMEM7 (NP_113628, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 83597

Enviar uma mensagem


TMEM7 polyclonal antibody (A01)

TMEM7 polyclonal antibody (A01)