BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)
  • BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)

BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00083596-B01P
BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BCL2L12 protein.
Información adicional
Size 50 ug
Gene Name BCL2L12
Gene Alias MGC120313|MGC120314|MGC120315
Gene Description BCL2-like 12 (proline rich)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCL2L12 (NP_001035758.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83596

Enviar uma mensagem


BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)

BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)