BCL2L12 polyclonal antibody (A01)
  • BCL2L12 polyclonal antibody (A01)

BCL2L12 polyclonal antibody (A01)

Ref: AB-H00083596-A01
BCL2L12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCL2L12.
Información adicional
Size 50 uL
Gene Name BCL2L12
Gene Alias MGC120313|MGC120314|MGC120315
Gene Description BCL2-like 12 (proline rich)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL2L12 (AAH07724, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 83596

Enviar uma mensagem


BCL2L12 polyclonal antibody (A01)

BCL2L12 polyclonal antibody (A01)