Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AKR1CL2 monoclonal antibody (M02), clone 1C8
Abnova
AKR1CL2 monoclonal antibody (M02), clone 1C8
Ref: AB-H00083592-M02
AKR1CL2 monoclonal antibody (M02), clone 1C8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant AKR1CL2.
Información adicional
Size
100 ug
Gene Name
AKR1CL2
Gene Alias
AKRDC1|LoopADR|MGC10612
Gene Description
aldo-keto reductase family 1, member C-like 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKR1CL2 (AAH02862, 1 a.a. ~ 307 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
83592
Clone Number
1C8
Iso type
IgG2a Kappa
Enviar uma mensagem
AKR1CL2 monoclonal antibody (M02), clone 1C8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*