TMUB1 purified MaxPab mouse polyclonal antibody (B01P)
  • TMUB1 purified MaxPab mouse polyclonal antibody (B01P)

TMUB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00083590-B01P
TMUB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMUB1 protein.
Información adicional
Size 50 ug
Gene Name TMUB1
Gene Alias C7orf21|MGC5442|SB144
Gene Description transmembrane and ubiquitin-like domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMUB1 (NP_113622, 1 a.a. ~ 246 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83590

Enviar uma mensagem


TMUB1 purified MaxPab mouse polyclonal antibody (B01P)

TMUB1 purified MaxPab mouse polyclonal antibody (B01P)