ARPC5L purified MaxPab mouse polyclonal antibody (B02P)
  • ARPC5L purified MaxPab mouse polyclonal antibody (B02P)

ARPC5L purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00081873-B02P
ARPC5L purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARPC5L protein.
Información adicional
Size 50 ug
Gene Name ARPC5L
Gene Alias ARC16-2|MGC3038
Gene Description actin related protein 2/3 complex, subunit 5-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARPC5L (NP_112240.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 81873

Enviar uma mensagem


ARPC5L purified MaxPab mouse polyclonal antibody (B02P)

ARPC5L purified MaxPab mouse polyclonal antibody (B02P)