CAB39L polyclonal antibody (A01)
  • CAB39L polyclonal antibody (A01)

CAB39L polyclonal antibody (A01)

Ref: AB-H00081617-A01
CAB39L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CAB39L.
Información adicional
Size 50 uL
Gene Name CAB39L
Gene Alias FLJ12577|MO25-BETA|MO2L|RP11-103J18.3|bA103J18.3
Gene Description calcium binding protein 39-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAB39L (AAH10993, 1 a.a. ~ 337 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 81617

Enviar uma mensagem


CAB39L polyclonal antibody (A01)

CAB39L polyclonal antibody (A01)