TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)
  • TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)

TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00081542-B01P
TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TXNDC1 protein.
Información adicional
Size 50 ug
Gene Name TXNDC1
Gene Alias DKFZp564E1962|TMX|TXNDC
Gene Description thioredoxin domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TXNDC1 (NP_110382.2, 1 a.a. ~ 280 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 81542

Enviar uma mensagem


TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)

TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)