TMPRSS5 MaxPab mouse polyclonal antibody (B01P)
  • TMPRSS5 MaxPab mouse polyclonal antibody (B01P)

TMPRSS5 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080975-B01P
TMPRSS5 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMPRSS5 protein.
Información adicional
Size 50 ug
Gene Name TMPRSS5
Gene Alias MGC141886|MGC148044|SPINESIN
Gene Description transmembrane protease, serine 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMPRSS5 (NP_110397, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80975

Enviar uma mensagem


TMPRSS5 MaxPab mouse polyclonal antibody (B01P)

TMPRSS5 MaxPab mouse polyclonal antibody (B01P)