View larger
Mouse monoclonal antibody raised against a partial recombinant APOL3.
AB-H00080833-M01A
New product
APOL3 monoclonal antibody (M01A), clone 4E5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | APOL3 |
| Gene Alias | APOLIII|CG12-1 |
| Gene Description | apolipoprotein L, 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 80833 |
| Clone Number | 4E5 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant APOL3.