AARSD1 MaxPab mouse polyclonal antibody (B01P)
  • AARSD1 MaxPab mouse polyclonal antibody (B01P)

AARSD1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080755-B01P
AARSD1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AARSD1 protein.
Información adicional
Size 50 ug
Gene Name AARSD1
Gene Alias MGC2744
Gene Description alanyl-tRNA synthetase domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AARSD1 (NP_079543, 1 a.a. ~ 525 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80755

Enviar uma mensagem


AARSD1 MaxPab mouse polyclonal antibody (B01P)

AARSD1 MaxPab mouse polyclonal antibody (B01P)