ZNF435 monoclonal antibody (M01), clone 4A9
  • ZNF435 monoclonal antibody (M01), clone 4A9

ZNF435 monoclonal antibody (M01), clone 4A9

Ref: AB-H00080345-M01
ZNF435 monoclonal antibody (M01), clone 4A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF435.
Información adicional
Size 100 ug
Gene Name ZSCAN16
Gene Alias FLJ22191|ZNF392|ZNF435|dJ265C24.3
Gene Description zinc finger and SCAN domain containing 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF435 (NP_079507.1, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80345
Clone Number 4A9
Iso type IgG2b Kappa

Enviar uma mensagem


ZNF435 monoclonal antibody (M01), clone 4A9

ZNF435 monoclonal antibody (M01), clone 4A9