TRAF3IP3 monoclonal antibody (M01), clone 7E10
  • TRAF3IP3 monoclonal antibody (M01), clone 7E10

TRAF3IP3 monoclonal antibody (M01), clone 7E10

Ref: AB-H00080342-M01
TRAF3IP3 monoclonal antibody (M01), clone 7E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRAF3IP3.
Información adicional
Size 100 ug
Gene Name TRAF3IP3
Gene Alias DJ434O14.3|FLJ44151|MGC117354|MGC163289|T3JAM
Gene Description TRAF3 interacting protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRAF3IP3 (NP_079504.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80342
Clone Number 7E10
Iso type IgG2a Lambda

Enviar uma mensagem


TRAF3IP3 monoclonal antibody (M01), clone 7E10

TRAF3IP3 monoclonal antibody (M01), clone 7E10