ALPK1 purified MaxPab mouse polyclonal antibody (B01P)
  • ALPK1 purified MaxPab mouse polyclonal antibody (B01P)

ALPK1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080216-B01P
ALPK1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALPK1 protein.
Información adicional
Size 50 ug
Gene Name ALPK1
Gene Alias 8430410J10Rik|FLJ22670|KIAA1527|LAK
Gene Description alpha-kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALPK1 (AAH60780.1, 1 a.a. ~ 1085 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80216

Enviar uma mensagem


ALPK1 purified MaxPab mouse polyclonal antibody (B01P)

ALPK1 purified MaxPab mouse polyclonal antibody (B01P)