TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)
  • TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)

TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00080194-D01P
TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TMEM134 protein.
Información adicional
Size 100 ug
Gene Name TMEM134
Gene Alias FLJ21749|MGC149891
Gene Description transmembrane protein 134
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM134 (NP_079400.1, 1 a.a. ~ 195 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80194

Enviar uma mensagem


TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)

TMEM134 purified MaxPab rabbit polyclonal antibody (D01P)