ASRGL1 MaxPab rabbit polyclonal antibody (D01)
  • ASRGL1 MaxPab rabbit polyclonal antibody (D01)

ASRGL1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00080150-D01
ASRGL1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASRGL1 protein.
Información adicional
Size 100 uL
Gene Name ASRGL1
Gene Alias ALP|ALP1|FLJ22316
Gene Description asparaginase like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASRGL1 (NP_001077395.1, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 80150

Enviar uma mensagem


ASRGL1 MaxPab rabbit polyclonal antibody (D01)

ASRGL1 MaxPab rabbit polyclonal antibody (D01)