VCPIP1 polyclonal antibody (A01)
  • VCPIP1 polyclonal antibody (A01)

VCPIP1 polyclonal antibody (A01)

Ref: AB-H00080124-A01
VCPIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VCPIP1.
Información adicional
Size 50 uL
Gene Name VCPIP1
Gene Alias DKFZp686G038|DUBA3|FLJ23132|FLJ60694|KIAA1850|VCIP135
Gene Description valosin containing protein (p97)/p47 complex interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLHNVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKTEPSVFTASSSNSELIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VCPIP1 (NP_079330, 1018 a.a. ~ 1114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 80124

Enviar uma mensagem


VCPIP1 polyclonal antibody (A01)

VCPIP1 polyclonal antibody (A01)